PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G36020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 629aa    MW: 68916.8 Da    PI: 4.0314
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G36020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.75.4e-17177219244
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
           SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44 
                      +i + + r+v ++kR++g++KKA EL +LC+++vav+ ++++g
  LPERR01G36020.1 177 PIADRRTRSVRYTKRKEGMMKKARELATLCGVQVAVVCAGPNG 219
                      688999***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.026168219IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-6170190IPR002100Transcription factor, MADS-box
SMARTSM004324.1E-13173227IPR002100Transcription factor, MADS-box
CDDcd002662.39E-23173252No hitNo description
SuperFamilySSF554554.97E-17173254IPR002100Transcription factor, MADS-box
PfamPF003192.0E-16178219IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-6190205IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-6205226IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MAQPVGYNSV QYMGVGMNGY QMQMQMPSND INSHGQLQCW DNNNFSQIQP APATNAGWHN  60
FGAWDNGGEP CNAIVPSADP YMDDIGGNYV DTTTVSDYQT NTDMSDYQIT TSTSTSDNFM  120
VMEAPVQFLT MGSDELLQCS DSTQNSPPLE QLHYLSDVDE LLQCNDPTQN SPIPIAPIAD  180
RRTRSVRYTK RKEGMMKKAR ELATLCGVQV AVVCAGPNGG APDVWTTPPK NEGDVSVIDK  240
YLALPAEKRA KHTHADYLRA LLGKKKADLA KLQQDGPDEL KPPKTVLDRM SQGELQQMLV  300
SIDATLQATA ERREALELMA AVAGDSGGDR RNADVPWPVS HGVPCTGTSS PGVHGYHAQV  360
HATCNPFQQE YTAGVTMTQP GVYNNVQYMG RHCLDMNGYD LQMQMQSNGV NSHGQLVWGD  420
FQPCNAAIAQ PAYGQLQCLD NNGGGGYQIQ SAPATNGVWH HPGAWDNGGE PCNAMVPSAD  480
PYMDDIGGNY VDTTTMPDYQ TTSSTSDNFM EAPVQFLTTG SDETQFSTDE LLQCSDSTQN  540
SPALEQLHYL SDVDELLQCS DSTQNSPPLE QLHYLSDVDE LLQRNDTTQN SPVLDQLHFF  600
SDMADGFDFG FESNFDFDEP LDLGWEMED
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640115.11e-120PREDICTED: uncharacterized protein LOC4324340
TrEMBLA0A0D9V9F30.0A0A0D9V9F3_9ORYZ; Uncharacterized protein
STRINGOB01G50150.11e-123(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45722960
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26650.12e-12AGAMOUS-like 36